PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016492492.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family B3
Protein Properties Length: 853aa    MW: 95643.3 Da    PI: 9.1926
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016492492.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B336.68.1e-12295381597
                     -..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE...EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE CS
              B3   5 ltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliy.rkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvf 97 
                     + ps+vlk  +++++ k a+++ +++ +   l l+ + g sW+v++++ + + + +     WkeFv +n+Lk gD++vF++++ s+  + v++f
  XP_016492492.1 295 MQPSYVLKPYIVSVSLKLARKYFLESYG--NLLLRVPGGGSWSVTHTIgTANAN-V----YWKEFVLDNKLKFGDVCVFEVIKGSKLLMDVTIF 381
                     7899******************888655..6***************65333332.2....3*******************99888887777777 PP

2B344.52.8e-14556647599
                     -..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE-S CS
              B3   5 ltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfrk 99 
                     + ps+v+k  +l +   fa+++  ++e++  l+l+ +   sW vk+    ++ ++ ++  Wk Fv +n+Lk gD++vF+l++ +e +l +++fr+
  XP_016492492.1 556 MQPSYVSKPYNLHIAFLFARKYF-PEECGNLLVLRVPGRGSWPVKYALGISKTKICFS--WKAFVLDNKLKFGDVCVFELIKGTEPTLDITIFRA 647
                     67999****99***********6.567999****************999999888888..*********************98888899999997 PP

3B345.21.7e-147638421294
                     HT...T-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EE CS
              B3  12 ks...grlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvv 94 
                     +     +l++  + a+++     ++ +++l+ +s +sW vk+i   +     lt+GWkeFv +n Lk+gD++vF++++r +   ++
  XP_016492492.1 763 SAsgpMQLSITLSRAKKFFAT--RHSDVVLQVSSKKSWAVKCIL--GTFNAKLTSGWKEFVLDNYLKVGDVCVFEMVSRAKL--LF 842
                     224447899999999999655..4558***************65..333345***********************8775444..43 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5086310.419165IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.101.9E-9576IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019361.33E-9565IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.105.5E-15283382IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019363.14E-15284381IPR015300DNA-binding pseudobarrel domain
CDDcd100173.15E-13289382No hitNo description
SMARTSM010191.4E-7291384IPR003340B3 DNA binding domain
PROSITE profilePS508639.418291384IPR003340B3 DNA binding domain
PfamPF023622.1E-8294381IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.103.7E-18544648IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019369.22E-18545647IPR015300DNA-binding pseudobarrel domain
SMARTSM010191.1E-12551648IPR003340B3 DNA binding domain
PROSITE profilePS5086311.223552648IPR003340B3 DNA binding domain
PfamPF023621.0E-11556647IPR003340B3 DNA binding domain
CDDcd100177.81E-17556646No hitNo description
Gene3DG3DSA:2.40.330.103.5E-20744848IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019362.16E-17745848IPR015300DNA-binding pseudobarrel domain
CDDcd100174.04E-13750847No hitNo description
PROSITE profilePS5086312.266755850IPR003340B3 DNA binding domain
SMARTSM010194.4E-4755850IPR003340B3 DNA binding domain
PfamPF023621.9E-12763843IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 853 aa     Download sequence    Send to blast
MLNPVYLEVP TGEVWEVEVV LSHGQICLGI GWQDFRDFYS ISCGHFLMFG YNARSHFNVS  60
IFDLSASEIE YPYSSAHGIH TPIFHCHETH HVPKRDQSGS DDSVEIVEDI PRSQKAKAKI  120
PDVVERSVEN PGHCPLGQCS KRKRQEGDAE HDVSVDVHVK RIKVEKLQED VASPSFSREG  180
QKHGEGTEIE HSVEILDHCP SGHDSKRKGL EGDAEDDVST DIHIRNIKVE KSREDVASPS  240
FTRKTKKSTE SCRMHKQQSK SVCDLNKTVM DKERAIAYQR AIAFKSKNPF IIAFMQPSYV  300
LKPYIVSVSL KLARKYFLES YGNLLLRVPG GGSWSVTHTI GTANANVYWK EFVLDNKLKF  360
GDVCVFEVIK GSKLLMDVTI FPAAGSTPMH KIAREEPGVC DCKNKINNTD NFVPCSQSKI  420
VQTKKLKQQR GGSYGSGSNS KEEHGEGTGI EHSVEILGHY PLGKSSKTKG PEEEIEDDVS  480
IDIHTKSIKV ENTQEHVASP SFTRKTKRSG ESCRMHKQQS KGVYAKNKTV LDKERSIAYQ  540
RAKAFKSENP FVIYFMQPSY VSKPYNLHIA FLFARKYFPE ECGNLLVLRV PGRGSWPVKY  600
ALGISKTKIC FSWKAFVLDN KLKFGDVCVF ELIKGTEPTL DITIFRATES KAIHKIDGKL  660
AGVSDSKNKI IKTENSVPCS QSKIVRNRKL NLEKKKKGDS DGFTSKIKEE LSEDTRKHVQ  720
QSKSSCNGSA VAKEIVLAYE RAKAYTSENP FFICFIQPSY VSSASGPMQL SITLSRAKKF  780
FATRHSDVVL QVSSKKSWAV KCILGTFNAK LTSGWKEFVL DNYLKVGDVC VFEMVSRAKL  840
LFNVIIFTSA EGM
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4i1k_A4e-1552564922144B3 domain-containing transcription factor VRN
4i1k_B4e-1552564922144B3 domain-containing transcription factor VRN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754411e-47HG975441.1 Solanum pennellii chromosome ch02, complete genome.
GenBankHG9755141e-47HG975514.1 Solanum lycopersicum chromosome ch02, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016492492.10.0PREDICTED: uncharacterized protein LOC107812001
TrEMBLK4B4X60.0K4B4X6_SOLLC; Uncharacterized protein
STRINGSolyc02g021260.1.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA7591893
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G49480.11e-16related to vernalization1 1